PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G62340.1
Common NameAtWRKY68, T12C14.40, WRKY68
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WRKY
Protein Properties Length: 277aa    MW: 31678.4 Da    PI: 7.4972
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G62340.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32117175159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk+s+fpr+YYrCt++ C vkk+vers +dp+ v++tYeg+H+h+
  AT3G62340.1 117 LDDGYKWRKYGQKPVKDSPFPRNYYRCTTTWCDVKKRVERSFSDPSSVITTYEGQHTHP 175
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381304.4E-9549277IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.805.9E-32104177IPR003657WRKY domain
SuperFamilySSF1182901.7E-28109177IPR003657WRKY domain
PROSITE profilePS5081130.836112177IPR003657WRKY domain
SMARTSM007741.4E-37117176IPR003657WRKY domain
PfamPF031069.1E-25118175IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MENVGVGMPF YDLGQTRVYP LLSDFHDLSA ERYPVGFMDL LGVHRHTPTH TPLMHFPTTP  60
NSSSSEAVNG DDEEEEDGEE QQHKTKKRFK FTKMSRKQTK KKVPKVSFIT RSEVLHLDDG  120
YKWRKYGQKP VKDSPFPRNY YRCTTTWCDV KKRVERSFSD PSSVITTYEG QHTHPRPLLI  180
MPKEGSSPSN GSASRAHIGL PTLPPQLLDY NNQQQQAPSS FGTEYINRQE KGINHDDDDD  240
HVVKKSRTRD LLDGAGLVKD HGLLQDVVPS HIIKEEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-251101771077Probable WRKY transcription factor 4
2lex_A6e-251101771077Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865113360.0
Expression AtlasAT3G62340-
AtGenExpressAT3G62340-
Functional Description ? help Back to Top
Source Description
TAIRmember of WRKY Transcription Factor; Group II-c
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G62340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G62340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4211550.0AF421155.1 Arabidopsis thaliana WRKY transcription factor 68 (WRKY68) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_567127.10.0putative WRKY transcription factor 68
SwissprotQ93WV60.0WRK68_ARATH; Probable WRKY transcription factor 68
TrEMBLR0HPI51e-142R0HPI5_9BRAS; Uncharacterized protein
STRINGAT3G62340.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150681619
Representative plantOGRP1417875
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]